Loading...
Statistics
Advertisement

Patty's Food — The Food We Love
www.pattysfood.com/
The Food We Love

Pattysfood.com

Advertisement
Conversion Technology Metas Server
Pattysfood.com is hosted in United States / Scottsdale . Pattysfood.com doesn't use HTTPS protocol. Number of used technologies: 7. First technologies: CSS, Font Awesome, Html, Number of used javascripts: 7. First javascripts: Jquery.js, Jquery-migrate.min.js, Zlrecipe_print.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Number of used plugins, modules: 3. Its server type is: Apache. Its CMS is: Wordpress.

Technologies in use by Pattysfood.com

Technology

Number of occurences: 7
  • CSS
  • Font Awesome
  • Html
  • Javascript
  • jQuery
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 7
  • jquery.js
  • jquery-migrate.min.js
  • zlrecipe_print.js
  • sb-instagram.js
  • superfish.min.js
  • superfish.args.min.js
  • superfish.compat.min.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache

CDN

Number of occurences: 1
  • BootstrapCDN

Used plugins, modules

Number of plugins and modules: 3
  • ziplist recipe plugin
  • instagram feed
  • genesis favicon uploader

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Pattysfood.com

Missing HTTPS protocol.

    Meta - Pattysfood.com

    Number of occurences: 3
    • Name:
      Content: text/html; charset=UTF-8
    • Name: description
      Content: The Food We Love
    • Name: robots
      Content: noodp,noydir

    Server / Hosting

    • IP: 184.168.165.1
    • Latitude: 33.61
    • Longitude: -111.89
    • Country: United States
    • City: Scottsdale

    Rname

    • ns67.domaincontrol.com
    • ns68.domaincontrol.com
    • mailstore1.secureserver.net
    • smtp.secureserver.net

    Target

    • dns.jomax.net

    HTTP Header Response

    HTTP/1.1 200 OK Date: Sun, 19 Jun 2016 07:19:15 GMT Server: Apache X-Pingback: http://pattysfood.com/xmlrpc.php Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_mf15 X-Cache-Lookup: MISS from s_mf15:80 Via: 1.1 s_mf15 (squid/3.5.6) Connection: keep-alive

    DNS

    host: pattysfood.com
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 184.168.165.1
    host: pattysfood.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns67.domaincontrol.com
    host: pattysfood.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns68.domaincontrol.com
    host: pattysfood.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns67.domaincontrol.com
    5. rname: dns.jomax.net
    6. serial: 2016050400
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 3600
    host: pattysfood.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mailstore1.secureserver.net
    host: pattysfood.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 0
    5. target: smtp.secureserver.net

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.attysfood.com, www.piattysfood.com, www.iattysfood.com, www.pkattysfood.com, www.kattysfood.com, www.puattysfood.com, www.uattysfood.com, www.pjattysfood.com, www.jattysfood.com, www.plattysfood.com, www.lattysfood.com, www.pttysfood.com, www.paottysfood.com, www.pottysfood.com, www.papttysfood.com, www.ppttysfood.com, www.pa9ttysfood.com, www.p9ttysfood.com, www.pattysfood.com, www.pttysfood.com, www.paittysfood.com, www.pittysfood.com, www.pauttysfood.com, www.puttysfood.com, www.patysfood.com, www.patqtysfood.com, www.paqtysfood.com, www.patatysfood.com, www.paatysfood.com, www.pat tysfood.com, www.pa tysfood.com, www.patwtysfood.com, www.pawtysfood.com, www.patetysfood.com, www.paetysfood.com, www.patztysfood.com, www.paztysfood.com, www.patxtysfood.com, www.paxtysfood.com, www.patctysfood.com, www.pactysfood.com, www.patysfood.com, www.pattqysfood.com, www.patqysfood.com, www.pattaysfood.com, www.pataysfood.com, www.patt ysfood.com, www.pat ysfood.com, www.pattwysfood.com, www.patwysfood.com, www.patteysfood.com, www.pateysfood.com, www.pattzysfood.com, www.patzysfood.com, www.pattxysfood.com, www.patxysfood.com, www.pattcysfood.com, www.patcysfood.com, www.pattsfood.com, www.pattyzsfood.com, www.pattzsfood.com, www.pattyasfood.com, www.pattasfood.com, www.pattyssfood.com, www.pattssfood.com, www.pattydsfood.com, www.pattdsfood.com, www.pattysfood.com, www.pattsfood.com, www.pattycsfood.com, www.pattcsfood.com, www.patty sfood.com, www.patt sfood.com, www.pattyfood.com, www.pattysefood.com, www.pattyefood.com, www.pattyswfood.com, www.pattywfood.com, www.pattysdfood.com, www.pattydfood.com, www.pattysxfood.com, www.pattyxfood.com, www.pattysffood.com, www.pattyffood.com, www.pattysgfood.com, www.pattygfood.com, www.pattystfood.com, www.pattytfood.com, www.pattysood.com, www.pattysfqood.com, www.pattysqood.com, www.pattysfood.com, www.pattysood.com, www.pattysfaood.com, www.pattysaood.com, www.pattysfyood.com, www.pattysyood.com, www.pattysftood.com, www.pattystood.com, www.pattysfgood.com, www.pattysgood.com, www.pattysfbood.com, www.pattysbood.com, www.pattysfwood.com, www.pattyswood.com, www.pattysfsood.com, www.pattyssood.com, www.pattysfdood.com, www.pattysdood.com, www.pattysfrood.com, www.pattysrood.com, www.pattysf3ood.com, www.pattys3ood.com, www.pattysf4ood.com, www.pattys4ood.com, www.pattysfod.com, www.pattysfobod.com, www.pattysfbod.com, www.pattysfohod.com, www.pattysfhod.com, www.pattysfogod.com, www.pattysfgod.com, www.pattysfojod.com, www.pattysfjod.com, www.pattysfomod.com, www.pattysfmod.com, www.pattysfo od.com, www.pattysf od.com, www.pattysfovod.com, www.pattysfvod.com, www.pattysfod.com, www.pattysfoobd.com, www.pattysfobd.com, www.pattysfoohd.com, www.pattysfohd.com, www.pattysfoogd.com, www.pattysfogd.com, www.pattysfoojd.com, www.pattysfojd.com, www.pattysfoomd.com, www.pattysfomd.com, www.pattysfoo d.com, www.pattysfo d.com, www.pattysfoovd.com, www.pattysfovd.com, www.pattysfoo.com, www.pattysfoodt.com, www.pattysfoot.com, www.pattysfoodg.com, www.pattysfoog.com, www.pattysfoodb.com, www.pattysfoob.com, www.pattysfoodx.com, www.pattysfoox.com, www.pattysfoods.com, www.pattysfoos.com, www.pattysfoodf.com, www.pattysfoof.com, www.pattysfoodv.com, www.pattysfoov.com, www.pattysfoody.com, www.pattysfooy.com, www.pattysfoodz.com, www.pattysfooz.com, www.pattysfooda.com, www.pattysfooa.com, www.pattysfoode.com, www.pattysfooe.com, www.pattysfoodr.com, www.pattysfoor.com,

    Other websites we recently analyzed

    1. organicdoctor.tv
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    2. Livingston Lures | Designed to call the fish to you!
      The first and only fishing lure to feature an internal sound chamber that emits the sound of an injured baitfish upon contact with water.
      San Antonio (United States) - 23.253.64.63
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Colorbox, jQuery Cycle, jQuery Fancybox, jQuery Hover Intent, Php, Swf Object, Facebook Retargeting, Google Analytics, Drupal, Facebook Box, Twitter Button
      Number of Javascript: 50
      Number of meta tags: 8
    3. 初年次教育学会（JAFYE）
      Tokyo (Japan) - 58.138.174.50
      Server software:
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 5
      Number of meta tags: 3
    4. eliorsh.com
      Scottsdale (United States) - 184.168.221.33
      Server software: squid/3.5.12
      Technology: Html, Html5, Iframe
    5. Propaganda Kompany
      Shop powered by PrestaShop
      France - 213.186.33.4
      Server software: Apache
      Technology: CSS, Html, Javascript, Php, Google Analytics, Prestashop
      Number of Javascript: 11
      Number of meta tags: 5
    6. Welcome to INSPIREDTRANSITION.COM
      Scottsdale (United States) - 184.168.221.96
      Server software: Microsoft-IIS/7.5
      Technology: Google Adsense, CSS, Html, Javascript
      Number of Javascript: 3
      Number of meta tags: 1
    7. maidservicegivesladyperfectlife.com
      United States - 66.151.177.21
      Server software: nginx
      Technology: DoubleClick.Net, CSS, Html, Javascript, Google Analytics
      Number of Javascript: 7
      Number of meta tags: 5
    8. schoene-natuerliche-zaehne.de
      Hier entsteht
      Germany - 89.31.143.16
      Server software: Apache
      Technology: CSS, Html, SVG
      Number of meta tags: 3
    9. Derek Nicolson Computer Services
      United Kingdom - 87.239.18.198
      Server software: nginx
      Technology: CSS, Html, Html5, Javascript, Php, Pingback, Wordpress
      Number of meta tags: 4
    10. cleariwirere.no.com
      San Jose (United States) - 205.164.14.88
      Server software: Tengine/1.4.2
      Technology: Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1

    Check Other Websites